PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_62.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 423aa    MW: 45243.9 Da    PI: 10.2727
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_62.4genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.41.8e-14344395556
                                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                                 +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ N++L  +  e+ ++ 
  evm.model.supercontig_62.4 344 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKELNQELERKQAEIMEMQ 395
                                 79*************************************9988877777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-12340405IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.703342393IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.9E-14344393No hitNo description
PfamPF001707.8E-12344396IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.31E-10344391No hitNo description
CDDcd147071.73E-25344398No hitNo description
PROSITE patternPS000360347362IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MNFKNFGDAS SGEGGNLRPV GNLPLARQSS VYSLTLDEFQ NTLGGMGKDF GSMNMDELLK  60
NIWSAEETQA MSSSAGGGGE GGVPGSNLQR QGSLTLPRTL SQKTVDEVWR DLIKESSVGV  120
AAKDVSDGVG GGAGGANMPQ RQQTLGEMTL EEFLVRAGVV REDTQQFGRP NNTGFYGNNT  180
ASLALGYQQQ TQNHGLLGNR APVPNQPSSF GLNVGRIRMS QQQPQQQQQP LFPKQATVAF  240
ASPVHLVNGG QLTSPASRGS IVGIGDPSLN NNLVQVGGLH SGGGIGMVGL GTGGVTVAAG  300
SPGRQISPDV ISKSSADNSS LSPVPYMFGR GRKCSAALEK VVERRQRRMI KNRESAARSR  360
ARKQAYTMEL EAEVAKLKEL NQELERKQAE IMEMQKTQLL DTMNQPWRSK RQCLRRTLTG  420
PW*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00038PBMTransfer from AT4G34000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007042439.10.0Abscisic acid responsive element-binding factor 1, putative isoform 1
RefseqXP_007042440.10.0Abscisic acid responsive element-binding factor 1, putative isoform 1
SwissprotQ9M7Q31e-127AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBLA0A061DZZ40.0A0A061DZZ4_THECC; Abscisic acid responsive element-binding factor 1, putative isoform 1
STRINGPOPTR_0009s10400.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Representative plantOGRP39841024
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34000.21e-100abscisic acid responsive elements-binding factor 3